PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 490687
Common NameARALYDRAFT_490687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 601aa    MW: 67355.3 Da    PI: 4.417
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
490687genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.51.5e-08445486144
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      r rW++++ el++++++++G++  + I + ++ +Rt++q k+++
           490687 445 RTRWSKQDTELFYEGIQEFGSN-LSMIQQLFP-NRTREQMKLKF 486
                      78******************99.*********.******99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159637.0E-26438522No hitNo description
SuperFamilySSF466893.51E-9439493IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-6442487IPR009057Homeodomain-like
PROSITE profilePS5129310.169443494IPR017884SANT domain
SMARTSM007174.1E-7444492IPR001005SANT/Myb domain
CDDcd001675.68E-5447487No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDLDFDDQPS DHAAPAVRAG ARFKPKGRPQ PKKKQVSLST SQTTISTDAA KEKLSTQNED  60
TVSLDGSSAI PSNALPSETN MPDSETIIKS TTGTLSEENV DVFPRGVHWS TRPSILRACN  120
NVDLVGKSCG DGIEAASSFP DDPRTQDSTI FGDYVTPETR EDEGRVDMET LDIVQEEGTT  180
SSYVQHTGKL QPKPRILDTV VEEPEPHYSA GDTGYFPMGT NESDFMVNVE SRNGFSSYGD  240
TQEEELNIPE APRDMVHEME ARNASGGWEH EEQGVSPCTN NTVTGEEENC LGKTVEEQSG  300
RESKTRKSKR ATSRKRKKTS EEPNKSSEKT EQKKFKHSSR RQKRTLEKEL LETPDDEIRF  360
LPLRDMLRLV EYKEWMEKKE AKGAGVQPSQ ESNMNASESQ YHSQGFDDED EFGEFGIESS  420
ENQENNVVKP DSPVNYQTYM NKTSRTRWSK QDTELFYEGI QEFGSNLSMI QQLFPNRTRE  480
QMKLKFKLEE RRNPLKLNDA LSSRSKHFTH FKNVIKKLQQ EAAAAKEAEE EEAGTEAETP  540
DVPENEEPEK SEETERASDG VAAGVKESDG GDIENGVRSD GGDECEDDED DFWSSYKSDM  600
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313317RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0234410.0BT023441.1 Arabidopsis thaliana At4g39160 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866831.10.0DNA binding protein
TrEMBLD7MGC00.0D7MGC0_ARALL; DNA binding protein
STRINGfgenesh2_kg.7__120__AT4G39160.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51542535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.10.0MYB_related family protein